Lineage for d1goib2 (1goi B:3-291,B:380-446)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 306351Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 306378Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 306379Species Serratia marcescens [TaxId:615] [51547] (10 PDB entries)
  8. 306381Domain d1goib2: 1goi B:3-291,B:380-446 [65417]
    Other proteins in same PDB: d1goia1, d1goia3, d1goib1, d1goib3
    complexed with gol, so4; mutant

Details for d1goib2

PDB Entry: 1goi (more details), 1.45 Å

PDB Description: crystal structure of the d140n mutant of chitinase b from serratia marcescens at 1.45 a resolution

SCOP Domain Sequences for d1goib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goib2 c.1.8.5 (B:3-291,B:380-446) Chitinase B, catalytic domain {Serratia marcescens}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
faqscvrimkdygfdgvnidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOP Domain Coordinates for d1goib2:

Click to download the PDB-style file with coordinates for d1goib2.
(The format of our PDB-style files is described here.)

Timeline for d1goib2: