SCOP 1.63: Domain d1goib2: 1goi B:3-291,B:380-446

Lineage for d1goib2 (1goi B:3-291,B:380-446)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.5: Type II chitinase [51534] (11 proteins)
   glycosylase family 18

6. Protein Chitinase B, catalytic domain [51546] (1 species)

7. Species Serratia marcescens [TaxId:615] [51547] (9 PDB entries)

8. Domain d1goib2: 1goi B:3-291,B:380-446 [65417]
   Other proteins in same PDB: d1goia1, d1goia3, d1goib1, d1goib3
   complexed with gol, so4; mutant

Details for d1goib2

PDB Entry: 1goi, 1.45 Å

PDB Description: crystal structure of the d140n mutant of chitinase b from serratia marcescens at 1.45 a resolution

SCOP Domain Sequences for d1goib2:

Sequence; same for both SEQRES and ATOM records:

>d1goib2 c.1.8.5 (B:3-291,B:380-446) Chitinase B, catalytic domain {Serratia marcescens}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
faqscvrimkdygfdgvnidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

Timeline for d1goib2:

• d1goib2 first appeared in SCOP 1.59
  
• d1goib2 appears in SCOP 1.61
  
• d1goib2 appears in SCOP 1.65
  
• d1goib2 appears in the current release, SCOPe 2.08