SCOP 1.65: Domain d1goib1: 1goi B:447-499

Lineage for d1goib1 (1goi B:447-499)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.72: WW domain-like [51044] (2 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family)

5. Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)

6. Protein Chitinase B, C-terminal domain [51061] (1 species)

7. Species Serratia marcescens [TaxId:615] [51062] (10 PDB entries)

8. Domain d1goib1: 1goi B:447-499 [65416]
   Other proteins in same PDB: d1goia2, d1goia3, d1goib2, d1goib3
   complexed with gol, so4; mutant

Details for d1goib1

PDB Entry: 1goi, 1.45 Å

PDB Description: crystal structure of the d140n mutant of chitinase b from serratia marcescens at 1.45 a resolution

SCOP Domain Sequences for d1goib1:

Sequence; same for both SEQRES and ATOM records:

>d1goib1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

Timeline for d1goib1:

• d1goib1 first appeared in SCOP 1.59
  
• d1goib1 appears in SCOP 1.63
  
• d1goib1 appears in SCOP 1.67
  
• d1goib1 appears in the current release, SCOPe 2.08