![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.72: WW domain-like [51044] (2 superfamilies) core: 3-stranded meander beta-sheet |
![]() | Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) ![]() |
![]() | Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins) |
![]() | Protein Chitinase B, C-terminal domain [51061] (1 species) |
![]() | Species Serratia marcescens [TaxId:615] [51062] (10 PDB entries) |
![]() | Domain d1goib1: 1goi B:447-499 [65416] Other proteins in same PDB: d1goia2, d1goia3, d1goib2, d1goib3 complexed with gol, so4; mutant |
PDB Entry: 1goi (more details), 1.45 Å
SCOP Domain Sequences for d1goib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1goib1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens} nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva
Timeline for d1goib1: