Class b: All beta proteins [48724] (119 folds) |
Fold b.72: WW domain-like [51044] (2 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) |
Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins) |
Protein Chitinase B, C-terminal domain [51061] (1 species) |
Species Serratia marcescens [TaxId:615] [51062] (9 PDB entries) |
Domain d1goib1: 1goi B:447-499 [65416] Other proteins in same PDB: d1goia2, d1goia3, d1goib2, d1goib3 complexed with gol, so4; mutant |
PDB Entry: 1goi (more details), 1.45 Å
SCOP Domain Sequences for d1goib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1goib1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens} nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva
Timeline for d1goib1: