Lineage for d1goia1 (1goi A:447-498)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 469730Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 469768Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) (S)
  5. 469769Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)
  6. 469776Protein Chitinase B, C-terminal domain [51061] (1 species)
  7. 469777Species Serratia marcescens [TaxId:615] [51062] (14 PDB entries)
  8. 469778Domain d1goia1: 1goi A:447-498 [65413]
    Other proteins in same PDB: d1goia2, d1goia3, d1goib2, d1goib3

Details for d1goia1

PDB Entry: 1goi (more details), 1.45 Å

PDB Description: crystal structure of the d140n mutant of chitinase b from serratia marcescens at 1.45 a resolution

SCOP Domain Sequences for d1goia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goia1 b.72.2.1 (A:447-498) Chitinase B, C-terminal domain {Serratia marcescens}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrv

SCOP Domain Coordinates for d1goia1:

Click to download the PDB-style file with coordinates for d1goia1.
(The format of our PDB-style files is described here.)

Timeline for d1goia1: