Lineage for d1goea_ (1goe A:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2650786Fold j.16: Corticotropin releasing hormone [58384] (1 superfamily)
  4. 2650787Superfamily j.16.1: Corticotropin releasing hormone [58385] (1 family) (S)
  5. 2650788Family j.16.1.1: Corticotropin releasing hormone [58386] (1 protein)
  6. 2650789Protein Corticotropin releasing hormone [58387] (3 species)
  7. 2650790Species Human (Homo sapiens) [TaxId:9606] [58388] (2 PDB entries)
  8. 2650792Domain d1goea_: 1goe A: [65412]

Details for d1goea_

PDB Entry: 1goe (more details)

PDB Description: monitoring the structural consequences of phe12-->d-phe12 and leu15-->aib15 substitution in h/r corticotropin releasing hormone: implications for design of crh antagonists.
PDB Compounds: (A:) corticotropin releasing hormone

SCOPe Domain Sequences for d1goea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goea_ j.16.1.1 (A:) Corticotropin releasing hormone {Human (Homo sapiens) [TaxId: 9606]}
seeppisldltfhlarevlemaraeqlaqqahsnrklmeii

SCOPe Domain Coordinates for d1goea_:

Click to download the PDB-style file with coordinates for d1goea_.
(The format of our PDB-style files is described here.)

Timeline for d1goea_: