Lineage for d1goea_ (1goe A:)
- Root: SCOP 1.61
Class j: Peptides [58231] (95 folds) 
Fold j.16: Corticotropin releasing hormone [58384] (1 superfamily) Superfamily j.16.1: Corticotropin releasing hormone [58385] (1 family) 
Family j.16.1.1: Corticotropin releasing hormone [58386] (1 protein) Protein Corticotropin releasing hormone [58387] (1 species) Species Human (Homo sapiens) [TaxId:9606] [58388] (2 PDB entries) 
Domain d1goea_: 1goe A: [65412]
Details for d1goea_
PDB Entry: 1goe (more details)
PDB Description: monitoring the structural consequences of phe12-->d-phe12 and leu15-->aib15 substitution in h/r corticotropin releasing hormone: implications for design of crh antagonists.
SCOP Domain Sequences for d1goea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1goea_ j.16.1.1 (A:) Corticotropin releasing hormone {Human (Homo sapiens)}
seeppisldltfhlarevlemaraeqlaqqahsnrklmeii
SCOP Domain Coordinates for d1goea_:
Click to download the PDB-style file with coordinates for d1goea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1goea_:
- d1goea_ first appeared in SCOP 1.59
- d1goea_ appears in SCOP 1.63
- d1goea_ appears in the current release, SCOPe 2.08
View in 3D