SCOPe 2.08: Domain d1goea_: 1goe A:

Lineage for d1goea_ (1goe A:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.16: Corticotropin releasing hormone [58384] (1 superfamily)

4. Superfamily j.16.1: Corticotropin releasing hormone [58385] (1 family)

5. Family j.16.1.1: Corticotropin releasing hormone [58386] (1 protein)

6. Protein Corticotropin releasing hormone [58387] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58388] (2 PDB entries)

8. Domain d1goea_: 1goe A: [65412]

Details for d1goea_

PDB Entry: 1goe

PDB Description: monitoring the structural consequences of phe12-->d-phe12 and leu15-->aib15 substitution in h/r corticotropin releasing hormone: implications for design of crh antagonists.

PDB Compounds: (A:) corticotropin releasing hormone

SCOPe Domain Sequences for d1goea_:

Sequence; same for both SEQRES and ATOM records:

>d1goea_ j.16.1.1 (A:) Corticotropin releasing hormone {Human (Homo sapiens) [TaxId: 9606]}
seeppisldltfhlarevlemaraeqlaqqahsnrklmeii

Timeline for d1goea_:

• d1goea_ first appeared in SCOP 1.59
  
• d1goea_ appears in SCOPe 2.07