SCOPe 2.07: Domain d1go9a_: 1go9 A:

Lineage for d1go9a_ (1go9 A:)

1. Root: SCOPe 2.07

2. Class j: Peptides [58231] (148 folds)

3. Fold j.16: Corticotropin releasing hormone [58384] (1 superfamily)

4. Superfamily j.16.1: Corticotropin releasing hormone [58385] (1 family)

5. Family j.16.1.1: Corticotropin releasing hormone [58386] (1 protein)

6. Protein Corticotropin releasing hormone [58387] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58388] (2 PDB entries)

8. Domain d1go9a_: 1go9 A: [65411]

Details for d1go9a_

PDB Entry: 1go9

PDB Description: monitoring the structural consequences of phe12-->d-phe12 and leu15-->aib15 substitution in h/r corticotropin releasing hormone: implications for design of crh antagonists.

PDB Compounds: (A:) corticotropin releasing hormone

SCOPe Domain Sequences for d1go9a_:

Sequence; same for both SEQRES and ATOM records:

>d1go9a_ j.16.1.1 (A:) Corticotropin releasing hormone {Human (Homo sapiens) [TaxId: 9606]}
seeppisldltfhlarevlemaraeqlaqqahsnrklmeii

Timeline for d1go9a_:

• d1go9a_ first appeared in SCOP 1.59
  
• d1go9a_ appears in SCOPe 2.06
  
• d1go9a_ appears in the current release, SCOPe 2.08