Lineage for d1go5a_ (1go5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696201Family a.5.2.3: TAP-C domain-like [68973] (2 proteins)
  6. 2696202Protein FG-binding, C-terminal domain of TAP [68974] (1 species)
  7. 2696203Species Human (Homo sapiens) [TaxId:9606] [68975] (2 PDB entries)
  8. 2696205Domain d1go5a_: 1go5 A: [65410]

Details for d1go5a_

PDB Entry: 1go5 (more details)

PDB Description: structure of the c-terminal fg-binding domain of human tap
PDB Compounds: (A:) tip associating protein

SCOPe Domain Sequences for d1go5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1go5a_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]}
paptpssspvptlspeqqemlqafstqsgmnlewsqkclqdnnwdytrsaqafthlkakg
eipevafmk

SCOPe Domain Coordinates for d1go5a_:

Click to download the PDB-style file with coordinates for d1go5a_.
(The format of our PDB-style files is described here.)

Timeline for d1go5a_: