SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1go5a_ (1go5 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1984734Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1984758Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1984917Family a.5.2.3: TAP-C domain-like [68973] (2 protein domains)
  6. 1984918Protein FG-binding, C-terminal domain of TAP [68974] (1 species)
  7. 1984919Species Human (Homo sapiens) [TaxId:9606] [68975] (2 PDB entries)
  8. 1984921Domain d1go5a_: 1go5 A: [65410]

Details for d1go5a_

PDB Entry: 1go5 (more details)

PDB Description: structure of the c-terminal fg-binding domain of human tap
PDB Compounds: (A:) tip associating protein

SCOPe Domain Sequences for d1go5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1go5a_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]}
paptpssspvptlspeqqemlqafstqsgmnlewsqkclqdnnwdytrsaqafthlkakg
eipevafmk

SCOPe Domain Coordinates for d1go5a_:

Click to download the PDB-style file with coordinates for d1go5a_.
(The format of our PDB-style files is described here.)

Timeline for d1go5a_: