SCOP 1.73: Domain d1go3f_: 1go3 F:

Lineage for d1go3f_ (1go3 F:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.8: HRDC-like [47819] (4 families)

5. Family a.60.8.2: RNA polymerase II subunit RBP4 (RpoF) [69044] (1 protein)

6. Protein RNA polymerase II subunit RBP4 (RpoF) [69045] (3 species)
   includes the N-terminal heterodimerisation alpha-hairpin

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [69046] (1 PDB entry)

8. Domain d1go3f_: 1go3 F: [65407]
   Other proteins in same PDB: d1go3e1, d1go3e2, d1go3m1, d1go3m2

Details for d1go3f_

PDB Entry: 1go3, 1.75 Å

PDB Description: structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex

PDB Compounds: (F:) DNA-directed RNA polymerase subunit f

SCOP Domain Sequences for d1go3f_:

Sequence; same for both SEQRES and ATOM records:

>d1go3f_ a.60.8.2 (F:) RNA polymerase II subunit RBP4 (RpoF) {Archaeon Methanococcus jannaschii [TaxId: 2190]}
migkkilgeryvtvseaaeimynraqigelsyeqgcaldylqkfakldkeeakklveeli
slgidektavkiadilpedlddlraiyykrelpenaeeileivrkyi

Timeline for d1go3f_:

• d1go3f_ first appeared in SCOP 1.59
  
• d1go3f_ appears in SCOP 1.71
  
• d1go3f_ appears in SCOP 1.75
  
• d1go3f_ appears in the current release, SCOPe 2.07