Lineage for d1gnza_ (1gnz A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226529Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 226650Protein Legume lectin [49904] (22 species)
  7. 226725Species Griffonia simplicifolia, lectin I-b4 [TaxId:3850] [69235] (2 PDB entries)
  8. 226728Domain d1gnza_: 1gnz A: [65405]
    complexed with nag, po4

Details for d1gnza_

PDB Entry: 1gnz (more details), 2.5 Å

PDB Description: lectin i-b4 from griffonia simplicifolia (gs i-b4)metal free form

SCOP Domain Sequences for d1gnza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnza_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4}
svsftfpnfwsdvedsiifqgdanttagtlqlcktnqygtplqwsagralysdpvqlwdn
ktesvasfyteftfflkitgngpadglafflappdsdvkdageylglfnkstatqpsknq
vvavefdtwtnpnfpepsyrhiginvnsivsvatkrwedsdifsgkiatarisydgsaei
ltvvlsypdgsdyilshsvdmrqnlpesvrvgisastgnnqfltvyilswrfssnl

SCOP Domain Coordinates for d1gnza_:

Click to download the PDB-style file with coordinates for d1gnza_.
(The format of our PDB-style files is described here.)

Timeline for d1gnza_: