Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.11: CBM15 [69216] (1 protein) automatically mapped to Pfam PF03426 |
Protein Xylan-binding module from xylanase 10c [69217] (1 species) |
Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [69218] (3 PDB entries) synonym: Pseudomonas cellulosa |
Domain d1gnya_: 1gny A: [65404] complexed with na |
PDB Entry: 1gny (more details), 1.63 Å
SCOPe Domain Sequences for d1gnya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gnya_ b.18.1.11 (A:) Xylan-binding module from xylanase 10c {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} gnvvievdmangwrgnasgstshsgitysadgvtfaalgdgvgavfdiarpttledavia mvvnvsaefkaseanlqifaqlkedwskgewdclagsseltadtdltltctidedddkfn qtardvqvgiqakgtpagtitiksvtitlaqea
Timeline for d1gnya_: