Lineage for d1gnya_ (1gny A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662025Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 662026Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) (S)
  5. 662291Family b.18.1.11: CBM15 [69216] (1 protein)
  6. 662292Protein Xylan-binding module from xylanase 10c [69217] (1 species)
  7. 662293Species Cellvibrio japonicus [TaxId:155077] [69218] (3 PDB entries)
    synonym: Pseudomonas cellulosa
  8. 662294Domain d1gnya_: 1gny A: [65404]
    complexed with na, xyp

Details for d1gnya_

PDB Entry: 1gny (more details), 1.63 Å

PDB Description: xylan-binding module cbm15
PDB Compounds: (A:) xylanase 10c

SCOP Domain Sequences for d1gnya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnya_ b.18.1.11 (A:) Xylan-binding module from xylanase 10c {Cellvibrio japonicus [TaxId: 155077]}
gnvvievdmangwrgnasgstshsgitysadgvtfaalgdgvgavfdiarpttledavia
mvvnvsaefkaseanlqifaqlkedwskgewdclagsseltadtdltltctidedddkfn
qtardvqvgiqakgtpagtitiksvtitlaqea

SCOP Domain Coordinates for d1gnya_:

Click to download the PDB-style file with coordinates for d1gnya_.
(The format of our PDB-style files is described here.)

Timeline for d1gnya_: