Lineage for d1gn4c2 (1gn4 C:86-199)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191397Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 191398Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 191399Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 191419Protein Fe superoxide dismutase (FeSOD) [54725] (7 species)
  7. 191446Species Mycobacterium tuberculosis [TaxId:1773] [54728] (5 PDB entries)
  8. 191453Domain d1gn4c2: 1gn4 C:86-199 [65384]
    Other proteins in same PDB: d1gn4a1, d1gn4b1, d1gn4c1, d1gn4d1

Details for d1gn4c2

PDB Entry: 1gn4 (more details), 2.5 Å

PDB Description: h145e mutant of mycobacterium tuberculosis iron-superoxide dismutase.

SCOP Domain Sequences for d1gn4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gn4c2 d.44.1.1 (C:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis}
nggdkptgelaaaiadafgsfdkfraqfhaaattvqgsgwaalgwdtlgnkllifqvyde
qtnfplgivplllldmwehafylqyknvkvdfakafwnvvnwadvqsryaaats

SCOP Domain Coordinates for d1gn4c2:

Click to download the PDB-style file with coordinates for d1gn4c2.
(The format of our PDB-style files is described here.)

Timeline for d1gn4c2: