![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [54728] (5 PDB entries) |
![]() | Domain d1gn2h2: 1gn2 H:86-199 [65374] Other proteins in same PDB: d1gn2a1, d1gn2b1, d1gn2c1, d1gn2d1, d1gn2e1, d1gn2f1, d1gn2g1, d1gn2h1 complexed with fe; mutant |
PDB Entry: 1gn2 (more details), 3.4 Å
SCOPe Domain Sequences for d1gn2h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gn2h2 d.44.1.1 (H:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} nggdkptgelaaaiadafgsfdkfraqfhaaattvqgcgwaalgwdtlgnkllifqvydh qtnfplgivplllldmwehafylqyknvkvdfakafwnvvnwadvqsryaaats
Timeline for d1gn2h2: