| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) ![]() |
| Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
| Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [54728] (5 PDB entries) |
| Domain d1gn2h2: 1gn2 H:86-199 [65374] Other proteins in same PDB: d1gn2a1, d1gn2b1, d1gn2c1, d1gn2d1, d1gn2e1, d1gn2f1, d1gn2g1, d1gn2h1 complexed with fe; mutant |
PDB Entry: 1gn2 (more details), 3.4 Å
SCOP Domain Sequences for d1gn2h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gn2h2 d.44.1.1 (H:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis}
nggdkptgelaaaiadafgsfdkfraqfhaaattvqgcgwaalgwdtlgnkllifqvydh
qtnfplgivplllldmwehafylqyknvkvdfakafwnvvnwadvqsryaaats
Timeline for d1gn2h2: