Lineage for d1gn2f2 (1gn2 F:86-199)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2552895Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2552923Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 2552948Species Mycobacterium tuberculosis [TaxId:1773] [54728] (5 PDB entries)
  8. 2552968Domain d1gn2f2: 1gn2 F:86-199 [65370]
    Other proteins in same PDB: d1gn2a1, d1gn2b1, d1gn2c1, d1gn2d1, d1gn2e1, d1gn2f1, d1gn2g1, d1gn2h1
    complexed with fe; mutant

Details for d1gn2f2

PDB Entry: 1gn2 (more details), 3.4 Å

PDB Description: s123c mutant of the iron-superoxide dismutase from mycobacterium tuberculosis.
PDB Compounds: (F:) superoxide dismutase

SCOPe Domain Sequences for d1gn2f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gn2f2 d.44.1.1 (F:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]}
nggdkptgelaaaiadafgsfdkfraqfhaaattvqgcgwaalgwdtlgnkllifqvydh
qtnfplgivplllldmwehafylqyknvkvdfakafwnvvnwadvqsryaaats

SCOPe Domain Coordinates for d1gn2f2:

Click to download the PDB-style file with coordinates for d1gn2f2.
(The format of our PDB-style files is described here.)

Timeline for d1gn2f2: