Lineage for d1gmzb_ (1gmz B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011697Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2011698Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2011703Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2011813Protein Snake phospholipase A2 [48624] (37 species)
  7. 2012004Species Snake (Bothrops pirajai), piratoxin III [TaxId:113192] [69123] (1 PDB entry)
    Uniprot Q9IAT9; Asp-49 phospholipase A2 homologue
  8. 2012006Domain d1gmzb_: 1gmz B: [65357]
    complexed with ipa

Details for d1gmzb_

PDB Entry: 1gmz (more details), 2.4 Å

PDB Description: crystal structure of the d49 phospholipase a2 piratoxin iii from bothrops pirajai.
PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d1gmzb_:

Sequence, based on SEQRES records: (download)

>d1gmzb_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Bothrops pirajai), piratoxin III [TaxId: 113192]}
dlwqfgkmilketgklpfpyyvtygcycgvggrggpkdatdrccfvhdccygkltsckpk
tdrysysrkdgtivcgendpcrkeicecdkaaavcfrenldtynkkymsylkslckkxad
dc

Sequence, based on observed residues (ATOM records): (download)

>d1gmzb_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Bothrops pirajai), piratoxin III [TaxId: 113192]}
dlwqfgkmilketgklpfpyyvtygcycgvggrggpkdatdrccfvhdccygkltsckpk
tdrysysrkdgtivcgedpcrkeicecdkaaavcfrenldtynkkymsylkslckkaddc

SCOPe Domain Coordinates for d1gmzb_:

Click to download the PDB-style file with coordinates for d1gmzb_.
(The format of our PDB-style files is described here.)

Timeline for d1gmzb_: