SCOPe 2.05: Domain d1gmxa_: 1gmx A:

Lineage for d1gmxa_ (1gmx A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.3: Single-domain sulfurtransferase [69509] (3 proteins)

6. Protein Sulfurtransferase GlpE [69510] (1 species)
   single-domain rhodanese

7. Species Escherichia coli [TaxId:562] [69511] (2 PDB entries)

8. Domain d1gmxa_: 1gmx A: [65355]
   complexed with act, edo

Details for d1gmxa_

PDB Entry: 1gmx, 1.1 Å

PDB Description: escherichia coli glpe sulfurtransferase

PDB Compounds: (A:) thiosulfate sulfurtransferase glpe

SCOPe Domain Sequences for d1gmxa_:

Sequence; same for both SEQRES and ATOM records:

>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]}
mdqfecinvadahqklqekeavlvdirdpqsfamghavqafhltndtlgafmrdndfdtp
vmvmcyhgnsskgaaqyllqqgydvvysidggfeawqrqfpaevayga

Timeline for d1gmxa_:

• d1gmxa_ first appeared in SCOP 1.59
  
• d1gmxa_ appears in SCOPe 2.04
  
• d1gmxa_ appears in SCOPe 2.06
  
• d1gmxa_ appears in the current release, SCOPe 2.08