Lineage for d1gmxa_ (1gmx A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852306Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 1852307Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 1852385Family c.46.1.3: Single-domain sulfurtransferase [69509] (3 proteins)
  6. 1852390Protein Sulfurtransferase GlpE [69510] (1 species)
    single-domain rhodanese
  7. 1852391Species Escherichia coli [TaxId:562] [69511] (2 PDB entries)
  8. 1852392Domain d1gmxa_: 1gmx A: [65355]
    complexed with act, edo

Details for d1gmxa_

PDB Entry: 1gmx (more details), 1.1 Å

PDB Description: escherichia coli glpe sulfurtransferase
PDB Compounds: (A:) thiosulfate sulfurtransferase glpe

SCOPe Domain Sequences for d1gmxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]}
mdqfecinvadahqklqekeavlvdirdpqsfamghavqafhltndtlgafmrdndfdtp
vmvmcyhgnsskgaaqyllqqgydvvysidggfeawqrqfpaevayga

SCOPe Domain Coordinates for d1gmxa_:

Click to download the PDB-style file with coordinates for d1gmxa_.
(The format of our PDB-style files is described here.)

Timeline for d1gmxa_: