SCOPe 2.06: Domain d1gmwd1: 1gmw D:1-70

Lineage for d1gmwd1 (1gmw D:1-70)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.107: Urease metallochaperone UreE, N-terminal domain [69286] (1 superfamily)
   barrel, closed; n=6, S=8; a crossover loop topology

4. Superfamily b.107.1: Urease metallochaperone UreE, N-terminal domain [69287] (1 family)
   automatically mapped to Pfam PF02814

5. Family b.107.1.1: Urease metallochaperone UreE, N-terminal domain [69288] (2 proteins)

6. Protein Urease metallochaperone UreE, N-terminal domain [69289] (2 species)

7. Species Klebsiella aerogenes [TaxId:28451] [69290] (3 PDB entries)

8. Domain d1gmwd1: 1gmw D:1-70 [65353]
   Other proteins in same PDB: d1gmwa2, d1gmwb2, d1gmwc2, d1gmwd2
   complexed with cu

Details for d1gmwd1

PDB Entry: 1gmw, 1.5 Å

PDB Description: structure of uree

PDB Compounds: (D:) uree

SCOPe Domain Sequences for d1gmwd1:

Sequence; same for both SEQRES and ATOM records:

>d1gmwd1 b.107.1.1 (D:1-70) Urease metallochaperone UreE, N-terminal domain {Klebsiella aerogenes [TaxId: 28451]}
mlyltqrleipaaatasvtlpidvrvksrvkvtlndgrdaglllprglllrggdvlsnee
gtdfvqviaa

Timeline for d1gmwd1:

• d1gmwd1 first appeared in SCOP 1.59
  
• d1gmwd1 appears in SCOPe 2.05
  
• d1gmwd1 appears in SCOPe 2.07
  
• d1gmwd1 appears in the current release, SCOPe 2.08