Lineage for d1gmwa1 (1gmw A:1-70)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820999Fold b.107: Urease metallochaperone UreE, N-terminal domain [69286] (1 superfamily)
    barrel, closed; n=6, S=8; a crossover loop topology
  4. 2821000Superfamily b.107.1: Urease metallochaperone UreE, N-terminal domain [69287] (1 family) (S)
    automatically mapped to Pfam PF02814
  5. 2821001Family b.107.1.1: Urease metallochaperone UreE, N-terminal domain [69288] (2 proteins)
  6. 2821002Protein Urease metallochaperone UreE, N-terminal domain [69289] (2 species)
  7. 2821006Species Klebsiella aerogenes [TaxId:28451] [69290] (3 PDB entries)
  8. 2821011Domain d1gmwa1: 1gmw A:1-70 [65347]
    Other proteins in same PDB: d1gmwa2, d1gmwb2, d1gmwc2, d1gmwd2
    complexed with cu

Details for d1gmwa1

PDB Entry: 1gmw (more details), 1.5 Å

PDB Description: structure of uree
PDB Compounds: (A:) uree

SCOPe Domain Sequences for d1gmwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmwa1 b.107.1.1 (A:1-70) Urease metallochaperone UreE, N-terminal domain {Klebsiella aerogenes [TaxId: 28451]}
mlyltqrleipaaatasvtlpidvrvksrvkvtlndgrdaglllprglllrggdvlsnee
gtefvqviaa

SCOPe Domain Coordinates for d1gmwa1:

Click to download the PDB-style file with coordinates for d1gmwa1.
(The format of our PDB-style files is described here.)

Timeline for d1gmwa1: