![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.107: Urease metallochaperone UreE, N-terminal domain [69286] (1 superfamily) barrel, closed; n=6, S=8; a crossover loop topology |
![]() | Superfamily b.107.1: Urease metallochaperone UreE, N-terminal domain [69287] (1 family) ![]() automatically mapped to Pfam PF02814 |
![]() | Family b.107.1.1: Urease metallochaperone UreE, N-terminal domain [69288] (2 proteins) |
![]() | Protein Urease metallochaperone UreE, N-terminal domain [69289] (2 species) |
![]() | Species Klebsiella aerogenes [TaxId:28451] [69290] (3 PDB entries) |
![]() | Domain d1gmwa1: 1gmw A:1-70 [65347] Other proteins in same PDB: d1gmwa2, d1gmwb2, d1gmwc2, d1gmwd2 complexed with cu |
PDB Entry: 1gmw (more details), 1.5 Å
SCOPe Domain Sequences for d1gmwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gmwa1 b.107.1.1 (A:1-70) Urease metallochaperone UreE, N-terminal domain {Klebsiella aerogenes [TaxId: 28451]} mlyltqrleipaaatasvtlpidvrvksrvkvtlndgrdaglllprglllrggdvlsnee gtefvqviaa
Timeline for d1gmwa1: