SCOPe 2.08: Domain d1gmuc1: 1gmu C:1-70

Lineage for d1gmuc1 (1gmu C:1-70)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.107: Urease metallochaperone UreE, N-terminal domain [69286] (1 superfamily)
   barrel, closed; n=6, S=8; a crossover loop topology

4. Superfamily b.107.1: Urease metallochaperone UreE, N-terminal domain [69287] (1 family)
   automatically mapped to Pfam PF02814

5. Family b.107.1.1: Urease metallochaperone UreE, N-terminal domain [69288] (2 proteins)

6. Protein Urease metallochaperone UreE, N-terminal domain [69289] (2 species)

7. Species Klebsiella aerogenes [TaxId:28451] [69290] (3 PDB entries)

8. Domain d1gmuc1: 1gmu C:1-70 [65339]
   Other proteins in same PDB: d1gmua2, d1gmub2, d1gmuc2, d1gmud2

Details for d1gmuc1

PDB Entry: 1gmu, 1.5 Å

PDB Description: structure of uree

PDB Compounds: (C:) uree

SCOPe Domain Sequences for d1gmuc1:

Sequence; same for both SEQRES and ATOM records:

>d1gmuc1 b.107.1.1 (C:1-70) Urease metallochaperone UreE, N-terminal domain {Klebsiella aerogenes [TaxId: 28451]}
mlyltqrleipaaatasvtlpidvrvksrvkvtlndgrdaglllprglllrggdvlsnee
gtefvqviaa

Timeline for d1gmuc1:

• d1gmuc1 first appeared in SCOP 1.59
  
• d1gmuc1 appears in SCOPe 2.07