SCOP 1.71: Domain d1gmoh2: 1gmo H:126-208

Lineage for d1gmoh2 (1gmo H:126-208)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (6 proteins)

6. Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57458] (5 PDB entries)

8. Domain d1gmoh2: 1gmo H:126-208 [65334]
   Other proteins in same PDB: d1gmoa1, d1gmob1, d1gmoc1, d1gmod1, d1gmoe1, d1gmof1, d1gmog1, d1gmoh1
   complexed with epe, ids, sgn, so4; mutant

Details for d1gmoh2

PDB Entry: 1gmo, 3 Å

PDB Description: crystal structures of nk1-heparin complexes reveal the basis for nk1 activity and enable engineering of potent agonists of the met receptor

SCOP Domain Sequences for d1gmoh2:

Sequence; same for both SEQRES and ATOM records:

>d1gmoh2 g.14.1.1 (H:126-208) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens)}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcse

Timeline for d1gmoh2:

• d1gmoh2 first appeared in SCOP 1.59
  
• d1gmoh2 appears in SCOP 1.69
  
• d1gmoh2 appears in SCOP 1.73
  
• d1gmoh2 appears in the current release, SCOPe 2.08