SCOPe 2.08: Domain d1gmoh1: 1gmo H:38-125

Lineage for d1gmoh1 (1gmo H:38-125)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
   automatically mapped to Pfam PF00024

6. Protein Hepatocyte growth factor [57416] (1 species)
   heparin-binding domain

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries)

8. Domain d1gmoh1: 1gmo H:38-125 [65333]
   Other proteins in same PDB: d1gmoa2, d1gmob2, d1gmoc2, d1gmod2, d1gmoe2, d1gmof2, d1gmog2, d1gmoh2
   complexed with epe, so4

Details for d1gmoh1

PDB Entry: 1gmo, 3 Å

PDB Description: crystal structures of nk1-heparin complexes reveal the basis for nk1 activity and enable engineering of potent agonists of the met receptor

PDB Compounds: (H:) hepatocyte growth factor

SCOPe Domain Sequences for d1gmoh1:

Sequence; same for both SEQRES and ATOM records:

>d1gmoh1 g.10.1.1 (H:38-125) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
tihefkksakttlikidpalkiktkkvntadqcadrctrnkglpftckafvfdkarkqcl
wfpfnsmssgvkkefghefdlyenkdyi

Timeline for d1gmoh1:

• d1gmoh1 first appeared in SCOP 1.59
  
• d1gmoh1 appears in SCOPe 2.07