Lineage for d1gmma_ (1gmm A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942101Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 942102Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 942407Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins)
  6. 942408Protein Carbohydrate binding module from xylanase U [69214] (1 species)
  7. 942409Species Clostridium thermocellum [TaxId:1515] [69215] (2 PDB entries)
  8. 942411Domain d1gmma_: 1gmm A: [65314]
    complexed with ca, na, so4

Details for d1gmma_

PDB Entry: 1gmm (more details), 2 Å

PDB Description: carbohydrate binding module cbm6 from xylanase u clostridium thermocellum
PDB Compounds: (A:) cbm6

SCOPe Domain Sequences for d1gmma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmma_ b.18.1.10 (A:) Carbohydrate binding module from xylanase U {Clostridium thermocellum [TaxId: 1515]}
fskieseeynslksstiqtigtsdggsgigyiesgdylvfnkinfgngansfkarvasga
dtptniqlrlgsptgtligtltvastggwnnyeekscsitnttgqhdlylvfsgpvnidy
fifdsn

SCOPe Domain Coordinates for d1gmma_:

Click to download the PDB-style file with coordinates for d1gmma_.
(The format of our PDB-style files is described here.)

Timeline for d1gmma_: