Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins) |
Protein Carbohydrate binding module from xylanase U [69214] (1 species) |
Species Clostridium thermocellum [TaxId:1515] [69215] (2 PDB entries) |
Domain d1gmma_: 1gmm A: [65314] complexed with ca, na, so4 |
PDB Entry: 1gmm (more details), 2 Å
SCOPe Domain Sequences for d1gmma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gmma_ b.18.1.10 (A:) Carbohydrate binding module from xylanase U {Clostridium thermocellum [TaxId: 1515]} fskieseeynslksstiqtigtsdggsgigyiesgdylvfnkinfgngansfkarvasga dtptniqlrlgsptgtligtltvastggwnnyeekscsitnttgqhdlylvfsgpvnidy fifdsn
Timeline for d1gmma_: