Lineage for d1gmma_ (1gmm A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) Superfamily b.18.1: Galactose-binding domain-like [49785] (13 families) 
Family b.18.1.10: CBM6 [69213] (1 protein) Protein Carbohydrate binding module from xylanase U [69214] (1 species) Species Clostridium thermocellum [TaxId:1515] [69215] (1 PDB entry) 
Domain d1gmma_: 1gmm A: [65314]
Details for d1gmma_
PDB Entry: 1gmm (more details), 2 Å
PDB Description: carbohydrate binding module cbm6 from xylanase u clostridium thermocellum
SCOP Domain Sequences for d1gmma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gmma_ b.18.1.10 (A:) Carbohydrate binding module from xylanase U {Clostridium thermocellum}
fskieseeynslksstiqtigtsdggsgigyiesgdylvfnkinfgngansfkarvasga
dtptniqlrlgsptgtligtltvastggwnnyeekscsitnttgqhdlylvfsgpvnidy
fifdsn
SCOP Domain Coordinates for d1gmma_:
Click to download the PDB-style file with coordinates for d1gmma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gmma_:
- d1gmma_ is new in SCOP 1.59
- d1gmma_ appears in SCOP 1.61
- d1gmma_ appears in the current release, SCOPe 2.08
View in 3D