Lineage for d1gmeb_ (1gme B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383524Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2383525Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2383526Family b.15.1.1: HSP20 [49765] (2 proteins)
  6. 2383527Protein Small heat shock protein [49766] (2 species)
  7. 2383547Species Wheat (Triticum aestivum) [TaxId:4565] [69208] (3 PDB entries)
  8. 2383549Domain d1gmeb_: 1gme B: [65306]

Details for d1gmeb_

PDB Entry: 1gme (more details), 2.7 Å

PDB Description: crystal structure and assembly of an eukaryotic small heat shock protein
PDB Compounds: (B:) heat shock protein 16.9b

SCOPe Domain Sequences for d1gmeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmeb_ b.15.1.1 (B:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]}
narmdwketpeahvfkadlpgvkkeevkvevedgnvlvvsgertkekedkndkwhrvers
sgkfvrrfrlledakveevkaglengvltvtvpkaevkkpevkaiqisg

SCOPe Domain Coordinates for d1gmeb_:

Click to download the PDB-style file with coordinates for d1gmeb_.
(The format of our PDB-style files is described here.)

Timeline for d1gmeb_: