SCOPe 2.03: Domain d1gm5a2: 1gm5 A:106-285

Lineage for d1gm5a2 (1gm5 A:106-285)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.9: RecG "wedge" domain [69259] (1 protein)

6. Protein RecG "wedge" domain [69260] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [69261] (1 PDB entry)

8. Domain d1gm5a2: 1gm5 A:106-285 [65299]
   Other proteins in same PDB: d1gm5a1, d1gm5a3, d1gm5a4
   complexed with adp, mg

Details for d1gm5a2

PDB Entry: 1gm5, 3.24 Å

PDB Description: structure of recg bound to three-way dna junction

PDB Compounds: (A:) recg

SCOPe Domain Sequences for d1gm5a2:

Sequence; same for both SEQRES and ATOM records:

>d1gm5a2 b.40.4.9 (A:106-285) RecG "wedge" domain {Thermotoga maritima [TaxId: 2336]}
csgeevdlstdiqyakgvgpnrkkklkklgietlrdlleffprdyedrrkifklndllpg
ekvttqgkivsvetkkfqnmniltavlsdglvhvplkwfnqdylqtylkqltgkevfvtg
tvksnaytgqyeihnaevtpkegeyvrrilpiyrltsgisqkqmrkifeenipslccslk

Timeline for d1gm5a2:

• d1gm5a2 first appeared in SCOP 1.59
  
• d1gm5a2 appears in SCOPe 2.02
  
• d1gm5a2 appears in SCOPe 2.04
  
• d1gm5a2 appears in the current release, SCOPe 2.08