Lineage for d1gm5a1 (1gm5 A:7-105)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1263159Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1263964Superfamily a.24.21: RecG, N-terminal domain [69008] (1 family) (S)
  5. 1263965Family a.24.21.1: RecG, N-terminal domain [69009] (1 protein)
  6. 1263966Protein RecG, N-terminal domain [69010] (1 species)
  7. 1263967Species Thermotoga maritima [TaxId:2336] [69011] (1 PDB entry)
  8. 1263968Domain d1gm5a1: 1gm5 A:7-105 [65298]
    Other proteins in same PDB: d1gm5a2, d1gm5a3, d1gm5a4
    complexed with adp, mg

Details for d1gm5a1

PDB Entry: 1gm5 (more details), 3.24 Å

PDB Description: structure of recg bound to three-way dna junction
PDB Compounds: (A:) recg

SCOPe Domain Sequences for d1gm5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gm5a1 a.24.21.1 (A:7-105) RecG, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
ftsslflwgealptlleeflnevekmlknqvntrrihqllkelddpllenkdleeklqaf
ldyvkeipnlpearkryriqkslemieklrswflidyle

SCOPe Domain Coordinates for d1gm5a1:

Click to download the PDB-style file with coordinates for d1gm5a1.
(The format of our PDB-style files is described here.)

Timeline for d1gm5a1: