Lineage for d1gm0a_ (1gm0 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1734834Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 1734835Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 1734836Protein Moth pheromone-binding protein, PBP [47569] (2 species)
  7. 1734841Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (4 PDB entries)
  8. 1734846Domain d1gm0a_: 1gm0 A: [65297]

Details for d1gm0a_

PDB Entry: 1gm0 (more details)

PDB Description: a form of the pheromone-binding protein from bombyx mori
PDB Compounds: (A:) pheromone-binding protein

SCOPe Domain Sequences for d1gm0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gm0a_ a.39.2.1 (A:) Moth pheromone-binding protein, PBP {Silkworm (Bombyx mori) [TaxId: 7091]}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavgeilaev

SCOPe Domain Coordinates for d1gm0a_:

Click to download the PDB-style file with coordinates for d1gm0a_.
(The format of our PDB-style files is described here.)

Timeline for d1gm0a_: