Lineage for d1gm0a_ (1gm0 A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) Fold a.39: EF Hand-like [47472] (4 superfamilies) 
Superfamily a.39.2: Insect pheromon/odorant-binding proteins [47565] (1 family) 
Family a.39.2.1: Insect pheromon/odorant-binding proteins [47566] (2 proteins) Protein Pheromone binding protein [47569] (1 species) Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (2 PDB entries) 
Domain d1gm0a_: 1gm0 A: [65297]
Details for d1gm0a_
PDB Entry: 1gm0 (more details)
PDB Description: a form of the pheromone-binding protein from bombyx mori
SCOP Domain Sequences for d1gm0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gm0a_ a.39.2.1 (A:) Pheromone binding protein {Silkworm (Bombyx mori)}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavgeilaev
SCOP Domain Coordinates for d1gm0a_:
Click to download the PDB-style file with coordinates for d1gm0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gm0a_:
- d1gm0a_ is new in SCOP 1.59
- d1gm0a_ appears in SCOP 1.61
- d1gm0a_ appears in the current release, SCOPe 2.08
View in 3D