Lineage for d1gl9c3 (1gl9 C:499-1054)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266966Fold e.10: Prokaryotic type I DNA topoisomerase [56711] (1 superfamily)
    4 domains: (1) Toprim alpha/beta; (2&4) "winged helix"-like; (3) barrel: n=6, S=8
  4. 266967Superfamily e.10.1: Prokaryotic type I DNA topoisomerase [56712] (1 family) (S)
    duplication: the protein chain passing through the domains 2-4 makes two structural repeats
    The active site is formed by the toprim and "winged helix" domains (domains 1 and 4); these two domains are also found in the type II topoisomerase (DNA gyrase A) and in the alpha subunit of topoisomerase IV
  5. 266968Family e.10.1.1: Prokaryotic type I DNA topoisomerase [56713] (3 proteins)
    domain 4 contains the catalytic tyrosine residue
  6. 266987Protein Topoisomerase "domain" of reverse gyrase [69890] (1 species)
  7. 266988Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69891] (2 PDB entries)
  8. 266991Domain d1gl9c3: 1gl9 C:499-1054 [65296]
    Other proteins in same PDB: d1gl9b1, d1gl9b2, d1gl9c1, d1gl9c2
    complexed with anp, mg; mutant

Details for d1gl9c3

PDB Entry: 1gl9 (more details), 3.2 Å

PDB Description: archaeoglobus fulgidus reverse gyrase complexed with adpnp

SCOP Domain Sequences for d1gl9c3:

Sequence, based on SEQRES records: (download)

>d1gl9c3 e.10.1.1 (C:499-1054) Topoisomerase "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus}
qefdlikpalfivesptkarqisrffgkpsvkvldgavvyeipmqkyvlmvtasighvvd
litnrgfhgvlvngrfvpvyasikrcrdcgyqftedrescpkcgsenvdnsrsriealrk
lahdaefvivgtdpdtegekiawdlknllsgcgavkraefhevtrrailealeslrdvde
nlvkaqvvrriedrwigfvlsqklwerfnnrnlsagraqtlvlgwiidrfqesrerrkia
ivrdfdlvlehdeeefdltiklveereelrtplppyttetmlsdanrilkfsvkqtmqia
qelfenglityhrtdstrvsdvgqriakeylgddfvgrewgesgahecirptrpltrddv
qrliqegvlvveglrwehfalydlifrrfmasqcrpfkvvvkkysiefdgktaeeerivr
aegrayelyravwvknelptgtfrvkaevksvpkvlpftqseiiqmmkergigrpstyat
ivdrlfmrnyvvekygrmiptklgidvfrflvrryakfvsedrtrdlesrmdaiergeld
ylkaledmyaeiksid

Sequence, based on observed residues (ATOM records): (download)

>d1gl9c3 e.10.1.1 (C:499-1054) Topoisomerase "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus}
qefdlikpalfivesptkarqisrffgkpsvkvldgavvyeipmqkyvlmvtasighvvd
litnrgfhgvlvngrfvpvyasikrcrvdnsrsriealrklahdaefvivgtdpdtegek
iawdlknllsgcgavkraefhevtrrailealeslrdvdenlvkaqvvrriedrwigfvl
sqklwerfnnrnlsagraqtlvlgwiidrfqesrerrkiaivrdfdlvldeeefdltikl
veereelrtplppyttetmlsdanrilkfsvkqtmqiaqelfenglityhrtdstrvsdv
gqriakeylgddfvgrewgesgahecirptrpltrddvqrliqegvlvveglrwehfaly
dlifrrfmasqcrpfkvvvkkysiefdeeerivraegrayelyravwvknelptgtfrvk
aevksvpkvlpftqseiiqmmkergigrpstyativdrlfmrnyvvekygrmiptklgid
vfrflvrryakfvsedrtrdlesrmdaiergeldylkaledmyaeiksid

SCOP Domain Coordinates for d1gl9c3:

Click to download the PDB-style file with coordinates for d1gl9c3.
(The format of our PDB-style files is described here.)

Timeline for d1gl9c3: