SCOPe 2.08: Domain d1gl9c1: 1gl9 C:3-250

Lineage for d1gl9c1 (1gl9 C:3-250)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.16: Helicase-like domain of reverse gyrase [69496] (1 protein)

6. Protein Helicase-like domain of reverse gyrase [69497] (1 species)
   contains a mobile insertion of LEM/SAP-like HeH motif, residues 354-423

7. Species Archaeoglobus fulgidus [TaxId:2234] [69498] (2 PDB entries)

8. Domain d1gl9c1: 1gl9 C:3-250 [65294]
   Other proteins in same PDB: d1gl9b3, d1gl9c3
   protein/DNA complex; complexed with anp, mg

Details for d1gl9c1

PDB Entry: 1gl9, 3.2 Å

PDB Description: archaeoglobus fulgidus reverse gyrase complexed with adpnp

PDB Compounds: (C:) reverse gyrase

SCOPe Domain Sequences for d1gl9c1:

Sequence, based on SEQRES records:

>d1gl9c1 c.37.1.16 (C:3-250) Helicase-like domain of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}
pvvysnlcpvcggdleskeiekhvcfrkkrslclfpedfllkefveffrkcvgepraiqk
mwakrilrkesfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirky
aekagvgtenligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvd
dvdailkasknvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnf
digssrit

Sequence, based on observed residues (ATOM records):

>d1gl9c1 c.37.1.16 (C:3-250) Helicase-like domain of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}
pvvyspvcggdleskeiekhrslclfpedfllkefveffrkcvgepraiqkmwakrilrk
esfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirkyaekagvgte
nligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvddvdailkas
knvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnfdigssrit

Timeline for d1gl9c1:

• d1gl9c1 first appeared in SCOP 1.59
  
• d1gl9c1 appears in SCOPe 2.07