Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.16: Helicase-like domain of reverse gyrase [69496] (1 protein) |
Protein Helicase-like domain of reverse gyrase [69497] (1 species) contains a mobile insertion of LEM/SAP-like HeH motif, residues 354-423 |
Species Archaeoglobus fulgidus [TaxId:2234] [69498] (2 PDB entries) |
Domain d1gl9c1: 1gl9 C:3-250 [65294] Other proteins in same PDB: d1gl9b3, d1gl9c3 protein/DNA complex; complexed with anp, mg |
PDB Entry: 1gl9 (more details), 3.2 Å
SCOPe Domain Sequences for d1gl9c1:
Sequence, based on SEQRES records: (download)
>d1gl9c1 c.37.1.16 (C:3-250) Helicase-like domain of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]} pvvysnlcpvcggdleskeiekhvcfrkkrslclfpedfllkefveffrkcvgepraiqk mwakrilrkesfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirky aekagvgtenligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvd dvdailkasknvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnf digssrit
>d1gl9c1 c.37.1.16 (C:3-250) Helicase-like domain of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]} pvvyspvcggdleskeiekhrslclfpedfllkefveffrkcvgepraiqkmwakrilrk esfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirkyaekagvgte nligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvddvdailkas knvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnfdigssrit
Timeline for d1gl9c1: