Lineage for d1gl9b3 (1gl9 B:499-1054)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 141306Fold e.10: Prokaryotic type I DNA topoisomerase [56711] (1 superfamily)
  4. 141307Superfamily e.10.1: Prokaryotic type I DNA topoisomerase [56712] (1 family) (S)
  5. 141308Family e.10.1.1: Prokaryotic type I DNA topoisomerase [56713] (3 proteins)
  6. 141327Protein Topoisomerase "domain" of reverse gyrase [69890] (1 species)
  7. 141328Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69891] (2 PDB entries)
  8. 141330Domain d1gl9b3: 1gl9 B:499-1054 [65293]
    Other proteins in same PDB: d1gl9b1, d1gl9b2, d1gl9c1, d1gl9c2

Details for d1gl9b3

PDB Entry: 1gl9 (more details), 3.2 Å

PDB Description: archaeoglobus fulgidus reverse gyrase complexed with adpnp

SCOP Domain Sequences for d1gl9b3:

Sequence, based on SEQRES records: (download)

>d1gl9b3 e.10.1.1 (B:499-1054) Topoisomerase "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus}
qefdlikpalfivesptkarqisrffgkpsvkvldgavvyeipmqkyvlmvtasighvvd
litnrgfhgvlvngrfvpvyasikrcrdcgyqftedrescpkcgsenvdnsrsriealrk
lahdaefvivgtdpdtegekiawdlknllsgcgavkraefhevtrrailealeslrdvde
nlvkaqvvrriedrwigfvlsqklwerfnnrnlsagraqtlvlgwiidrfqesrerrkia
ivrdfdlvlehdeeefdltiklveereelrtplppyttetmlsdanrilkfsvkqtmqia
qelfenglityhrtdstrvsdvgqriakeylgddfvgrewgesgahecirptrpltrddv
qrliqegvlvveglrwehfalydlifrrfmasqcrpfkvvvkkysiefdgktaeeerivr
aegrayelyravwvknelptgtfrvkaevksvpkvlpftqseiiqmmkergigrpstyat
ivdrlfmrnyvvekygrmiptklgidvfrflvrryakfvsedrtrdlesrmdaiergeld
ylkaledmyaeiksid

Sequence, based on observed residues (ATOM records): (download)

>d1gl9b3 e.10.1.1 (B:499-1054) Topoisomerase "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus}
qefdlikpalfivesptkarqisrffgkpsvkvldgavvyeipmqkyvlmvtasighvvd
litnrgfhgvlvngrfvpvyasikvdnsrsriealrklahdaefvivgtdpdtegekiaw
dlknllsgcgavkraefhevtrrailealeslrdvdenlvkaqvvrriedrwigfvlsqk
lwerfnnrnlsagraqtlvlgwiidrfqesrerrkiaivrdfdlvlehdeeefdltiklv
eereelrtplppyttetmlsdanrilkfsvkqtmqiaqelfenglityhrtdstrvsdvg
qriakeylgddfvgrewgesgahecirptrpltrddvqrliqegvlvveglrwehfalyd
lifrrfmasqcrpfkvvvkkysiefdgktaeeerivraegrayelyravwvknelptgtf
rvkaevksvpkvlpftqseiiqmmkergigrpstyativdrlfmrnyvvekygrmiptkl
gidvfrflvrryakfvsedrtrdlesrmdaiergeldylkaledmyaeiksid

SCOP Domain Coordinates for d1gl9b3:

Click to download the PDB-style file with coordinates for d1gl9b3.
(The format of our PDB-style files is described here.)

Timeline for d1gl9b3: