Lineage for d1gl9b2 (1gl9 B:251-498)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1848935Family c.37.1.16: Helicase-like "domain" of reverse gyrase [69496] (1 protein)
  6. 1848936Protein Helicase-like "domain" of reverse gyrase [69497] (1 species)
    contains a mobile insertion of LEM/SAP-like HeH motif, residues 354-423
  7. 1848937Species Archaeoglobus fulgidus [TaxId:2234] [69498] (2 PDB entries)
  8. 1848941Domain d1gl9b2: 1gl9 B:251-498 [65292]
    Other proteins in same PDB: d1gl9b3, d1gl9c3
    protein/DNA complex; complexed with anp, mg

Details for d1gl9b2

PDB Entry: 1gl9 (more details), 3.2 Å

PDB Description: archaeoglobus fulgidus reverse gyrase complexed with adpnp
PDB Compounds: (B:) reverse gyrase

SCOPe Domain Sequences for d1gl9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gl9b2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}
vrnvedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfrigivtatkkg
dyekfvegeidhligtahyygtlvrgldlperirfavfvgcpsfrvtiedidslspqmvk
llaylyrnvdeierllpaverhidevreilkkvmgkerpqakdvvvregevifpdlrtyi
qgsgrtsrlfaggltkgasflleddsellsafieraklydiefksidevdfeklsrelde
srdryrrr

SCOPe Domain Coordinates for d1gl9b2:

Click to download the PDB-style file with coordinates for d1gl9b2.
(The format of our PDB-style files is described here.)

Timeline for d1gl9b2: