| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.16: Helicase-like "domain" of reverse gyrase [69496] (1 protein) |
| Protein Helicase-like "domain" of reverse gyrase [69497] (1 species) contains a mobile insertion of LEM/SAP-like HeH motif, residues 354-423 |
| Species Archaeoglobus fulgidus [TaxId:2234] [69498] (2 PDB entries) |
| Domain d1gl9b2: 1gl9 B:251-498 [65292] Other proteins in same PDB: d1gl9b3, d1gl9c3 protein/DNA complex; complexed with anp, mg |
PDB Entry: 1gl9 (more details), 3.2 Å
SCOPe Domain Sequences for d1gl9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gl9b2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}
vrnvedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfrigivtatkkg
dyekfvegeidhligtahyygtlvrgldlperirfavfvgcpsfrvtiedidslspqmvk
llaylyrnvdeierllpaverhidevreilkkvmgkerpqakdvvvregevifpdlrtyi
qgsgrtsrlfaggltkgasflleddsellsafieraklydiefksidevdfeklsrelde
srdryrrr
Timeline for d1gl9b2: