Lineage for d1gl9b1 (1gl9 B:2-250)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597246Family c.37.1.16: Helicase-like "domain" of reverse gyrase [69496] (1 protein)
  6. 1597247Protein Helicase-like "domain" of reverse gyrase [69497] (1 species)
    contains a mobile insertion of LEM/SAP-like HeH motif, residues 354-423
  7. 1597248Species Archaeoglobus fulgidus [TaxId:2234] [69498] (2 PDB entries)
  8. 1597251Domain d1gl9b1: 1gl9 B:2-250 [65291]
    Other proteins in same PDB: d1gl9b3, d1gl9c3
    protein/DNA complex; complexed with anp, mg

Details for d1gl9b1

PDB Entry: 1gl9 (more details), 3.2 Å

PDB Description: archaeoglobus fulgidus reverse gyrase complexed with adpnp
PDB Compounds: (B:) reverse gyrase

SCOPe Domain Sequences for d1gl9b1:

Sequence, based on SEQRES records: (download)

>d1gl9b1 c.37.1.16 (B:2-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}
ipvvysnlcpvcggdleskeiekhvcfrkkrslclfpedfllkefveffrkcvgepraiq
kmwakrilrkesfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirk
yaekagvgtenligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifv
ddvdailkasknvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqlln
fdigssrit

Sequence, based on observed residues (ATOM records): (download)

>d1gl9b1 c.37.1.16 (B:2-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}
ipvvypvcggleskeiekhkrslclfpedfllkefveffrkcvgepraiqkmwakrilrk
esfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirkyaekagvgte
nligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvddvdailkas
knvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnfdigssrit

SCOPe Domain Coordinates for d1gl9b1:

Click to download the PDB-style file with coordinates for d1gl9b1.
(The format of our PDB-style files is described here.)

Timeline for d1gl9b1: