Lineage for d1gl9b1 (1gl9 B:2-250)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 180362Family c.37.1.16: Helicase-like "domain" of reverse gyrase [69496] (1 protein)
  6. 180363Protein Helicase-like "domain" of reverse gyrase [69497] (1 species)
  7. 180364Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69498] (2 PDB entries)
  8. 180367Domain d1gl9b1: 1gl9 B:2-250 [65291]
    Other proteins in same PDB: d1gl9b3, d1gl9c3

Details for d1gl9b1

PDB Entry: 1gl9 (more details), 3.2 Å

PDB Description: archaeoglobus fulgidus reverse gyrase complexed with adpnp

SCOP Domain Sequences for d1gl9b1:

Sequence, based on SEQRES records: (download)

>d1gl9b1 c.37.1.16 (B:2-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus}
ipvvysnlcpvcggdleskeiekhvcfrkkrslclfpedfllkefveffrkcvgepraiq
kmwakrilrkesfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirk
yaekagvgtenligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifv
ddvdailkasknvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqlln
fdigssrit

Sequence, based on observed residues (ATOM records): (download)

>d1gl9b1 c.37.1.16 (B:2-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus}
ipvvypvcggleskeiekhkrslclfpedfllkefveffrkcvgepraiqkmwakrilrk
esfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirkyaekagvgte
nligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvddvdailkas
knvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnfdigssrit

SCOP Domain Coordinates for d1gl9b1:

Click to download the PDB-style file with coordinates for d1gl9b1.
(The format of our PDB-style files is described here.)

Timeline for d1gl9b1: