Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Perlecan Ig3 domain [69158] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [69159] (1 PDB entry) |
Domain d1gl4b_: 1gl4 B: [65288] Other proteins in same PDB: d1gl4a1, d1gl4a2 complexed with epe, zn |
PDB Entry: 1gl4 (more details), 2 Å
SCOPe Domain Sequences for d1gl4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} pimvtveeqrsqsvrpgadvtfictakskspaytlvwtrlhngklpsramdfngiltirn vqpsdagtyvctgsnmfamdqgtatlhvq
Timeline for d1gl4b_: