SCOPe 2.07: Domain d1gl4b_: 1gl4 B:

Lineage for d1gl4b_ (1gl4 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Perlecan Ig3 domain [69158] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [69159] (1 PDB entry)

8. Domain d1gl4b_: 1gl4 B: [65288]
   Other proteins in same PDB: d1gl4a1, d1gl4a2
   complexed with epe, zn

Details for d1gl4b_

PDB Entry: 1gl4, 2 Å

PDB Description: nidogen-1 g2/perlecan ig3 complex

PDB Compounds: (B:) basement membrane-specific heparan sulfate proteoglycan core protein

SCOPe Domain Sequences for d1gl4b_:

Sequence; same for both SEQRES and ATOM records:

>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]}
pimvtveeqrsqsvrpgadvtfictakskspaytlvwtrlhngklpsramdfngiltirn
vqpsdagtyvctgsnmfamdqgtatlhvq

Timeline for d1gl4b_:

• d1gl4b_ first appeared in SCOP 1.59
  
• d1gl4b_ appears in SCOPe 2.06
  
• d1gl4b_ appears in the current release, SCOPe 2.08