Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.2: Domain G2 of nidogen-1 [64244] (1 protein) automatically mapped to Pfam PF07474 |
Protein Domain G2 of nidogen-1 [64245] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [64246] (2 PDB entries) |
Domain d1gl4a1: 1gl4 A:399-631 [65286] Other proteins in same PDB: d1gl4a2, d1gl4b_ complexed with epe, zn |
PDB Entry: 1gl4 (more details), 2 Å
SCOPe Domain Sequences for d1gl4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gl4a1 d.22.1.2 (A:399-631) Domain G2 of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} gspqrvngkvkgrifvgssqvpvvfentdlhsyvvmnhgrsytaistipetvgysllpla piggiigwmfaveqdgfkngfsitggeftrqaevtflghpgklvlkqqfsgidehghlti stelegrvpqipygasvhiepytelyhysssvitssstreytvmepdqdgaapshthiyq wrqtitfqecahddarpalpstqqlsvdsvfvlynkeerilryalsnsigpvr
Timeline for d1gl4a1: