SCOPe 2.01: Domain d1gl4a1: 1gl4 A:399-631

Lineage for d1gl4a1 (1gl4 A:399-631)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.2: Domain G2 of nidogen-1 [64244] (1 protein)

6. Protein Domain G2 of nidogen-1 [64245] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64246] (2 PDB entries)

8. Domain d1gl4a1: 1gl4 A:399-631 [65286]
   Other proteins in same PDB: d1gl4a2, d1gl4b_
   complexed with epe, zn

Details for d1gl4a1

PDB Entry: 1gl4, 2 Å

PDB Description: nidogen-1 g2/perlecan ig3 complex

PDB Compounds: (A:) nidogen-1

SCOPe Domain Sequences for d1gl4a1:

Sequence; same for both SEQRES and ATOM records:

>d1gl4a1 d.22.1.2 (A:399-631) Domain G2 of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]}
gspqrvngkvkgrifvgssqvpvvfentdlhsyvvmnhgrsytaistipetvgysllpla
piggiigwmfaveqdgfkngfsitggeftrqaevtflghpgklvlkqqfsgidehghlti
stelegrvpqipygasvhiepytelyhysssvitssstreytvmepdqdgaapshthiyq
wrqtitfqecahddarpalpstqqlsvdsvfvlynkeerilryalsnsigpvr

Timeline for d1gl4a1:

• d1gl4a1 first appeared in SCOP 1.59
  
• d1gl4a1 appears in SCOP 1.75
  
• d1gl4a1 appears in SCOPe 2.02
  
• d1gl4a1 appears in the current release, SCOPe 2.08