Lineage for d1gl4a1 (1gl4 A:399-631)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190674Fold d.22: GFP-like [54510] (1 superfamily)
  4. 190675Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 190730Family d.22.1.2: Domain G2 of nidogen-1 [64244] (1 protein)
  6. 190731Protein Domain G2 of nidogen-1 [64245] (1 species)
  7. 190732Species Mouse (Mus musculus) [TaxId:10090] [64246] (2 PDB entries)
  8. 190733Domain d1gl4a1: 1gl4 A:399-631 [65286]
    Other proteins in same PDB: d1gl4a2, d1gl4b_

Details for d1gl4a1

PDB Entry: 1gl4 (more details), 2 Å

PDB Description: nidogen-1 g2/perlecan ig3 complex

SCOP Domain Sequences for d1gl4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gl4a1 d.22.1.2 (A:399-631) Domain G2 of nidogen-1 {Mouse (Mus musculus)}
gspqrvngkvkgrifvgssqvpvvfentdlhsyvvmnhgrsytaistipetvgysllpla
piggiigwmfaveqdgfkngfsitggeftrqaevtflghpgklvlkqqfsgidehghlti
stelegrvpqipygasvhiepytelyhysssvitssstreytvmepdqdgaapshthiyq
wrqtitfqecahddarpalpstqqlsvdsvfvlynkeerilryalsnsigpvr

SCOP Domain Coordinates for d1gl4a1:

Click to download the PDB-style file with coordinates for d1gl4a1.
(The format of our PDB-style files is described here.)

Timeline for d1gl4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gl4a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1gl4b_