Lineage for d1gl3b2 (1gl3 B:134-354)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1915728Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 1915729Species Escherichia coli [TaxId:562] [55362] (4 PDB entries)
    Uniprot P00353
  8. 1915736Domain d1gl3b2: 1gl3 B:134-354 [65285]
    Other proteins in same PDB: d1gl3a1, d1gl3b1
    complexed with cys, ndp

Details for d1gl3b2

PDB Entry: 1gl3 (more details), 2.6 Å

PDB Description: aspartate beta-semialdehyde dehydrogenase in complex with nadp and substrate analogue s-methyl cysteine sulfoxide
PDB Compounds: (B:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1gl3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gl3b2 d.81.1.1 (B:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]}
nctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmghlyghvadelatp
ssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsreewkgqaetnkil
ntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnpwakvvpndreitm
reltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwg

SCOPe Domain Coordinates for d1gl3b2:

Click to download the PDB-style file with coordinates for d1gl3b2.
(The format of our PDB-style files is described here.)

Timeline for d1gl3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gl3b1