SCOPe 2.03: Domain d1gl3b1: 1gl3 B:1-133,B:355-367

Lineage for d1gl3b1 (1gl3 B:1-133,B:355-367)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)

7. Species Escherichia coli [TaxId:562] [51814] (4 PDB entries)
   Uniprot P00353

8. Domain d1gl3b1: 1gl3 B:1-133,B:355-367 [65284]
   Other proteins in same PDB: d1gl3a2, d1gl3b2
   complexed with cys, ndp

Details for d1gl3b1

PDB Entry: 1gl3, 2.6 Å

PDB Description: aspartate beta-semialdehyde dehydrogenase in complex with nadp and substrate analogue s-methyl cysteine sulfoxide

PDB Compounds: (B:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1gl3b1:

Sequence; same for both SEQRES and ATOM records:

>d1gl3b1 c.2.1.3 (B:1-133,B:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]}
mknvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
dglnngirtfvggXaaeplrrmlrqla

Timeline for d1gl3b1:

• d1gl3b1 first appeared in SCOP 1.59
  
• d1gl3b1 appears in SCOPe 2.02
  
• d1gl3b1 appears in SCOPe 2.04
  
• d1gl3b1 appears in the current release, SCOPe 2.08