Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Aspartate beta-semialdehyde dehydrogenase [51813] (3 species) |
Species Escherichia coli [TaxId:562] [51814] (4 PDB entries) |
Domain d1gl3b1: 1gl3 B:1-133,B:355-367 [65284] Other proteins in same PDB: d1gl3a2, d1gl3b2 |
PDB Entry: 1gl3 (more details), 2.6 Å
SCOP Domain Sequences for d1gl3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gl3b1 c.2.1.3 (B:1-133,B:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli} mknvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit dglnngirtfvggXaaeplrrmlrqla
Timeline for d1gl3b1: