Lineage for d1gl3b1 (1gl3 B:1-133,B:355-367)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118409Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)
  6. 118415Protein Aspartate beta-semialdehyde dehydrogenase [51813] (1 species)
  7. 118416Species Escherichia coli [TaxId:562] [51814] (2 PDB entries)
  8. 118418Domain d1gl3b1: 1gl3 B:1-133,B:355-367 [65284]
    Other proteins in same PDB: d1gl3a2, d1gl3b2

Details for d1gl3b1

PDB Entry: 1gl3 (more details), 2.6 Å

PDB Description: aspartate beta-semialdehyde dehydrogenase in complex with nadp and substrate analogue s-methyl cysteine sulfoxide

SCOP Domain Sequences for d1gl3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gl3b1 c.2.1.3 (B:1-133,B:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli}
mknvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
dglnngirtfvggXaaeplrrmlrqla

SCOP Domain Coordinates for d1gl3b1:

Click to download the PDB-style file with coordinates for d1gl3b1.
(The format of our PDB-style files is described here.)

Timeline for d1gl3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gl3b2