SCOPe 2.02: Domain d1gl3a2: 1gl3 A:134-354

Lineage for d1gl3a2 (1gl3 A:134-354)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)

7. Species Escherichia coli [TaxId:562] [55362] (4 PDB entries)
   Uniprot P00353

8. Domain d1gl3a2: 1gl3 A:134-354 [65283]
   Other proteins in same PDB: d1gl3a1, d1gl3b1
   complexed with cys, ndp

Details for d1gl3a2

PDB Entry: 1gl3, 2.6 Å

PDB Description: aspartate beta-semialdehyde dehydrogenase in complex with nadp and substrate analogue s-methyl cysteine sulfoxide

PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1gl3a2:

Sequence; same for both SEQRES and ATOM records:

>d1gl3a2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]}
nctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmghlyghvadelatp
ssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsreewkgqaetnkil
ntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnpwakvvpndreitm
reltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwg

Timeline for d1gl3a2:

• d1gl3a2 first appeared in SCOP 1.59
  
• d1gl3a2 appears in SCOPe 2.01
  
• d1gl3a2 appears in SCOPe 2.03
  
• d1gl3a2 appears in the current release, SCOPe 2.08