Lineage for d1gl0i_ (1gl0 I:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 428309Fold g.4: PMP inhibitors [57282] (1 superfamily)
    disulfide-rich fold; all-beta: 3 antiparallel strands
  4. 428310Superfamily g.4.1: PMP inhibitors [57283] (1 family) (S)
  5. 428311Family g.4.1.1: PMP inhibitors [57284] (4 proteins)
  6. 428318Protein Protease inhibitor PMP-D2V [69943] (1 species)
  7. 428319Species Migratory locust (Locusta migratoria) [TaxId:7004] [69944] (1 PDB entry)
  8. 428320Domain d1gl0i_: 1gl0 I: [65271]
    Other proteins in same PDB: d1gl0e_
    complexed with cd; mutant

Details for d1gl0i_

PDB Entry: 1gl0 (more details), 3 Å

PDB Description: structure of the complex between bovine alpha-chymotrypsin and pmp-d2v, an inhibitor from the insect locusta migratoria

SCOP Domain Sequences for d1gl0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gl0i_ g.4.1.1 (I:) Protease inhibitor PMP-D2V {Migratory locust (Locusta migratoria)}
kctpgqvkqqdcntctctptgvwgctlmgcqp

SCOP Domain Coordinates for d1gl0i_:

Click to download the PDB-style file with coordinates for d1gl0i_.
(The format of our PDB-style files is described here.)

Timeline for d1gl0i_:

428320
d1gl0i_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1gl0e_