Lineage for d1gkxa2 (1gkx A:186-378)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732553Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 732554Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 732754Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (2 proteins)
  6. 732755Protein Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) [69805] (1 species)
  7. 732756Species Rat (Rattus norvegicus) [TaxId:10116] [69806] (3 PDB entries)
  8. 732758Domain d1gkxa2: 1gkx A:186-378 [65267]
    Other proteins in same PDB: d1gkxa1
    complexed with cl

Details for d1gkxa2

PDB Entry: 1gkx (more details), 2.3 Å

PDB Description: branched-chain alpha-ketoacid dehydrogenase kinase (bck)
PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase

SCOP Domain Sequences for d1gkxa2:

Sequence, based on SEQRES records: (download)

>d1gkxa2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
aeastqdprisplfghldmhsggqsgpmhgfgfglptsrayaeylggslqlqslqgigtd
vylrlrhidgree

Sequence, based on observed residues (ATOM records): (download)

>d1gkxa2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhfgf
glptsrayaeylggslqlqslqgigtdvylrlrhidgree

SCOP Domain Coordinates for d1gkxa2:

Click to download the PDB-style file with coordinates for d1gkxa2.
(The format of our PDB-style files is described here.)

Timeline for d1gkxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gkxa1