Lineage for d1gkxa1 (1gkx A:38-185)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912955Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 913171Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (1 family) (S)
  5. 913172Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (2 proteins)
  6. 913173Protein Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) [69014] (1 species)
  7. 913174Species Norway rat (Rattus norvegicus) [TaxId:10116] [69015] (3 PDB entries)
  8. 913176Domain d1gkxa1: 1gkx A:38-185 [65266]
    Other proteins in same PDB: d1gkxa2
    complexed with cl

Details for d1gkxa1

PDB Entry: 1gkx (more details), 2.3 Å

PDB Description: branched-chain alpha-ketoacid dehydrogenase kinase (bck)
PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase

SCOPe Domain Sequences for d1gkxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkxa1 a.29.5.1 (A:38-185) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vrltptmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhe
lyirafqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvr
yfldktltsrlgirmlathhlalhedkp

SCOPe Domain Coordinates for d1gkxa1:

Click to download the PDB-style file with coordinates for d1gkxa1.
(The format of our PDB-style files is described here.)

Timeline for d1gkxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gkxa2